SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000454146 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000454146
Domain Number 1 Region: 1-52
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000356
Family FCH domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000454146   Gene: ENSG00000182511   Transcript: ENST00000470152
Sequence length 121
Comment pep:known chromosome:GRCh38:15:90884447:90889378:1 gene:ENSG00000182511 transcript:ENST00000470152 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MGFSSELCSPQGHGVLQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSLQDSGGQS
RAISPDSPISQVGLYGTLVGAGCICLLLPLLGALWGSGWRSGRPMLGSHCAPLPASPICA
V
Download sequence
Identical sequences H0YNT6
ENSP00000454146 ENSP00000454146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]