SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000454307 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000454307
Domain Number 1 Region: 4-102
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.87e-16
Family G proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000454307   Gene: ENSG00000140983   Transcript: ENST00000561983
Sequence length 135
Comment pep:known chromosome:GRCh38:16:668105:671199:1 gene:ENSG00000140983 transcript:ENST00000561983 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MRRDVRILLLGEAQVGKTSLILSLVGEEFPEEVPPRAEEITIPADVTPEKVPTHIVDYSE
AEQTDEELREEIHKANVVCVVYDVSEEATIEKIRTKWIPLVNGGTTQGPSGQQVRPAVGE
LHGGRAPHHEPVSRD
Download sequence
Identical sequences H3BUX4
ENSP00000454307 ENSP00000457852 ENSP00000454307 ENSP00000457852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]