SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000455047 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455047
Domain Number 1 Region: 43-189
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.39e-24
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0054
Further Details:      
 
Domain Number 2 Region: 156-277
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.48e-18
Family FAD/NAD-linked reductases, N-terminal and central domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455047   Gene: ENSG00000260170   Transcript: ENST00000564080
Sequence length 289
Comment pep:novel chromosome:GRCh38:15:45587351:45676314:1 gene:ENSG00000260170 transcript:ENST00000564080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPLVAVVSGPRAQLFACLLRLGTQQVGPLQLHTGASHAARNHYEVLVLGGGSGGITMAA
RMKRKVGAENVAIVEPSERHFYQPIWTLVGAGAKQLSSSGRPTASVIPSGVEWIKARVTE
LNPDKNCIHTDDDEKISYRYLIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWK
ALQDFKEGNAIFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKANIIFNTSLGAIFGVK
KYADALQEIIQERNLTVNYKKNLIEVRADKQEAVFENLDKPGETQVISV
Download sequence
Identical sequences H3BNX3
ENSP00000455047 ENSP00000455047 ENSP00000455047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]