SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000455285 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455285
Domain Number 1 Region: 58-115
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00009
Family UbiE/COQ5-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455285   Gene: ENSG00000197006   Transcript: ENST00000568826
Sequence length 125
Comment pep:novel chromosome:GRCh38:16:21612700:21655281:1 gene:ENSG00000197006 transcript:ENST00000568826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGVLGINEWQNTGFQY
DVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVENVGGKWEKPSEILE
IKGQN
Download sequence
Identical sequences H3BPE9
ENSP00000455285 ENSP00000455285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]