SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000455360 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455360
Domain Number 1 Region: 46-209
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.32e-40
Family AlaX-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455360   Gene: ENSG00000090861   Transcript: ENST00000565361
Sequence length 280
Comment pep:novel chromosome:GRCh38:16:70254390:70262361:-1 gene:ENSG00000090861 transcript:ENST00000565361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XDSSEDKTEFTVKNAQVRGGYVLHIGTIYGDLKVGDQVWLFIDEPRRRPIMSNHTATHIL
NFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIANEMIEAAKAVYTQDC
PLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLDDPSGPAGSLTSVEFCGGTHLRNS
SHAGAFVIVTEEAIAKGIRRIVAVTGAEAQKALRKAESLKKCLSVMEAKVKAQTAPNKDV
QREIADLGEPCSRDPMDPVLGPWTFPAAPSAASRRALPKH
Download sequence
Identical sequences H3BPK7
ENSP00000455360 ENSP00000455360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]