SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000455456 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000455456
Domain Number - Region: 11-64
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000141
Family Carboxypeptidase regulatory domain 0.035
Further Details:      
 
Domain Number - Region: 112-153
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0188
Family Rhamnogalacturonase B, RhgB, middle domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455456   Gene: ENSG00000185164   Transcript: ENST00000569051
Sequence length 223
Comment pep:known chromosome:GRCh38:16:18520899:18533102:-1 gene:ENSG00000185164 transcript:ENST00000569051 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XSSQDKDKSLVTVETDAHGSFCFKAKPGTYKVQVMVPEAETRAGLTLKPQTFPLTVTDRP
VMDVAFVQFLASVSGKVSCLDTCGDLLVTLQSLSRQGEKRSLQLSGKVNAMTFTFDNVLP
GKYKISIMHEDWCWKNKSLEVEVLEDDVSAVEFRQTGYMLRCSLSHAITLAQPYCSGEMC
PGTSELKTPRNFIRMEMGVRMWGFITSPKESTDSACPSLVCTK
Download sequence
Identical sequences H3BPS9
ENSP00000455456 ENSP00000455456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]