SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000455499 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455499
Domain Number 1 Region: 2-63
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 9.68e-18
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455499   Gene: ENSG00000138621   Transcript: ENST00000569562
Sequence length 64
Comment pep:putative chromosome:GRCh38:15:75023590:75049182:1 gene:ENSG00000138621 transcript:ENST00000569562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAWDRSKPLLFCPAMNTAMWEHPITAQQVDQLKAFGYVEIPCVAKKLVCGDEGLGAMAE
VGTI
Download sequence
Identical sequences H3BPW5
ENSP00000455499 ENSP00000455499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]