SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000455586 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455586
Domain Number 1 Region: 39-129
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.49e-36
Family SCAN domain 0.0000872
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455586   Gene: ENSG00000155592   Transcript: ENST00000569150
Sequence length 232
Comment pep:known chromosome:GRCh38:16:25239494:25257557:-1 gene:ENSG00000155592 transcript:ENST00000569150 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAVALDSQIDAPLEVEGCLIMKVEKDPEWASEPILEGSDSSETFRKCFRQFCYEDVTGPH
EAFSKLWELCCRWLKPEMRSKEQILELLVIEQFLTILPEKIQAWAQKQCPQSGEEAVALV
VHLEKETGRLRQQVSSPVHREKHSPLGAAWEVADFQPEQVETQPRAVSREEPGSLHSGHQ
EQLNRKRERRPLPKNARPSPWVPALADEWNTLDQEVTTTRLPAGSQCHYRNQ
Download sequence
Identical sequences H3BQ35
ENSP00000455586 ENSP00000455586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]