SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000455630 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000455630
Domain Number - Region: 43-64
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.0051
Family Integrin alpha N-terminal domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455630   Gene: ENSG00000129636   Transcript: ENST00000563730
Sequence length 74
Comment pep:putative chromosome:GRCh38:16:47451396:47464149:-1 gene:ENSG00000129636 transcript:ENST00000563730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVLLTYLPKNYAKSELGAVIFWGQNQTLDPNNMTILNRTFQDEPLIMDFNGDLIPDIFG
ITNESNQPQILLGG
Download sequence
Identical sequences A0A2J8VY10
ENSP00000455630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]