SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000455651 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455651
Domain Number 1 Region: 13-90
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000201
Family WD40-repeat 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455651   Gene: ENSG00000125124   Transcript: ENST00000562012
Sequence length 119
Comment pep:known chromosome:GRCh38:16:56499832:56509989:-1 gene:ENSG00000125124 transcript:ENST00000562012 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
DEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTSRYWRIKSKNHAMSIHAFDLN
SDGVNELITGWSNGKVDARSDRTGEVIFKDNFSSAIAGVVEGDYRMDGHIHPGLPAWHG
Download sequence
Identical sequences A0A2J8MWK7 H3BQ79
ENSP00000455651 ENSP00000455651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]