SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000455755 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455755
Domain Number 1 Region: 3-181
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 6.27e-29
Family UbiE/COQ5-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455755   Gene: ENSG00000258539   Transcript: ENST00000494792
Sequence length 201
Comment pep:known chromosome:GRCh38:10:124617080:124791727:-1 gene:ENSG00000258539 transcript:ENST00000494792 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XHWDAVYERELQTFREYGDTGEIWFGEESMNRLIRWMQKHKIPLDASVLDIGTGNGVFLV
ELAKFGFSNITGIDYSPSAIQLSGSIIEKEGLSNIKLKVEDFLNLSTQLSGFHICIDKGT
FDAISLNPDNAIEKRKQYVKSLSRVLKVKGFFLITSCNWTKEELLNEFSEGFELLEELPT
PKFSFGGRSGNSVAALVFQKM
Download sequence
Identical sequences H3BQF6
ENSP00000455755 ENSP00000455755 ENSP00000455755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]