SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000455764 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455764
Domain Number 1 Region: 43-258,363-445
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.45e-55
Family FAD-linked reductases, N-terminal domain 0.00023
Further Details:      
 
Domain Number 2 Region: 260-362
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.59e-19
Family L-aminoacid/polyamine oxidase 0.046
Further Details:      
 
Domain Number 3 Region: 455-488
Classification Level Classification E-value
Superfamily Folate-binding domain 0.00000549
Family Aminomethyltransferase folate-binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455764   Gene: ENSG00000090857   Transcript: ENST00000565186
Sequence length 491
Comment pep:known chromosome:GRCh38:16:70120131:70158331:1 gene:ENSG00000090857 transcript:ENST00000565186 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MMFYRLLSIVGRQRASPGWQNWSSARNSTSAAEARSMALPTQAQVVICGGGITGTSVAYH
LSKMGWKDIVLLEQGRLAAGSTRFCAGILSTARHLTIEQKMADYSNKLYYQLEQETGIQT
GYTRTGSIFLAQTQDRLISLKRINAGLNVIGIPSEIISPKKVAELHHLLNVHDLVGAMHV
PEDAVVSSADVALALASAASQNGVQIYDRTSVLHVMVKKGQVTGVETDKGQIECQYFVNC
AGQWAYELGLSNEEPVSIPLHACEHFYLLTRPLETPLQSSTPTIVDADGRIYIRNWQGGI
LSGGFEKNPKPIFTEGKNQLEIQNLQEDWDHFEPLLSSLLRRMPELETLEIMKLVNCPET
FTPDMRCIMGESPAVQGYFVLAGMNSAGLSFGGGAGKYLAEWMVHGYPSENVWELDLKRF
GALQSSRTFLRHRVMEVMPLMYDLKVPRWDFQTGRQLRTSPLYDRLDAQGARWMEKHGFE
RPKYFVPPDKG
Download sequence
Identical sequences H3BQG3
ENSP00000455764 ENSP00000455764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]