SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000456019 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000456019
Domain Number 1 Region: 43-142,239-354
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.7e-25
Family FAD/NAD-linked reductases, N-terminal and central domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000456019   Gene: ENSG00000137767   Transcript: ENST00000568606
Sequence length 450
Comment pep:known chromosome:GRCh38:15:45631148:45691280:1 gene:ENSG00000137767 transcript:ENST00000568606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPLVAVVSGPRAQLFACLLRLGTQQVGPLQLHTGASHAARNHYEVLVLGGGSGGITMAA
RMKRKVGAENVAIVEPSERHFYQPIWTLVGAGAKQLSSSGRPTASVIPSGVEWIKARVTE
LNPDKNCIHTDDDEKISYRYLIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWK
ALQDFKEGNAIFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKANIIFNTSLGAIFGVK
KYADALQEIIQERNLTVNYKKNLIEVRADKQEAVFENLDKPGETQVISYEMLHVTPPMSP
PDVLKTSPVADAAGWVDVDKETLQHRRYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTI
SVIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYLMKAD
LMPFLYWNMMLRGYWGGPAFLRKLFHLGMS
Download sequence
Identical sequences A0A024R5X2 Q9Y6N5
ENSP00000260324 NP_001258142.1.87134 NP_001258142.1.92137 NP_067022.1.87134 NP_067022.1.92137 ENSP00000260324 ENSP00000456019 9606.ENSP00000260324 gi|10864011|ref|NP_067022.1| ENSP00000260324 ENSP00000456019 GO.35463 HR6618 SQRDL

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]