SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000456212 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000456212
Domain Number - Region: 12-35
Classification Level Classification E-value
Superfamily CHY zinc finger-like 0.00222
Family CHY zinc finger 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000456212   Gene: ENSG00000090238   Transcript: ENST00000566401
Sequence length 54
Comment pep:known chromosome:GRCh38:16:30094853:30096241:-1 gene:ENSG00000090238 transcript:ENST00000566401 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSV
Download sequence
Identical sequences A0A2J8ISX8 A0A2J8TJZ1 H3BRF0
ENSP00000456212 ENSP00000456212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]