SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000456353 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000456353
Domain Number 1 Region: 14-163
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 4.45e-47
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000456353   Gene: ENSG00000138621   Transcript: ENST00000567336
Sequence length 172
Comment pep:novel chromosome:GRCh38:15:75028249:75049538:1 gene:ENSG00000138621 transcript:ENST00000567336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPKASCPAAAPLMERKFHVLVGVTGSVAALKLPLLVSKLLDIPGIWKSRSDPVLHIDLR
RWADLLLVAPLDANTLGKVASGICDNLLTCVMRAWDRSKPLLFCPAMNTAMWEHPITAQQ
VDQLKAFGYVEIPCVAKKLVCGDEGLGAMAEVGTIVDKVKEVLFQHSGFQQS
Download sequence
Identical sequences H3BRQ0
ENSP00000456353 NP_001288031.1.87134 NP_001288031.1.92137 ENSP00000456353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]