SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000456446 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000456446
Domain Number - Region: 3-51
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0209
Family Integrin beta tail domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000456446   Gene: ENSG00000139626   Transcript: ENST00000551319
Sequence length 117
Comment pep:putative chromosome:GRCh38:12:53191323:53192488:-1 gene:ENSG00000139626 transcript:ENST00000551319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSTACAHTNVTLALAPILDDGWCKERTLDNQLFFFLVEDDARGTVVLRVRPQEKGADHTQ
AIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLNWKQLLGFGSRLAS
Download sequence
Identical sequences H3BRX4
ENSP00000456446 ENSP00000456446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]