SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000456501 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000456501
Domain Number 1 Region: 131-190
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000133
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.014
Further Details:      
 
Weak hits

Sequence:  ENSP00000456501
Domain Number - Region: 170-179,211-230,380-431
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00201
Family Cytochrome c3-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000456501   Gene: ENSG00000140995   Transcript: ENST00000569453
Sequence length 451
Comment pep:known chromosome:GRCh38:16:89948791:89966066:1 gene:ENSG00000140995 transcript:ENST00000569453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYDEKLARFRQAHLNPFNKQSGPRQHEQGPGEEVPDVTPEEALPELPPGEPEFRCPERV
MDLGLSEDHFSRPVGLFLASDVQQLRQAIEECKQVILELPEQSEKQKDAVVRLIHLRLKL
QELKDPNEDEPNIRVLLEHRFYKEKSKSVKQTCDKCNTIIWGLIQTWYTCTGCYYRCHSK
CLNLISKPCVSSKVSHQAEYELNICPETGLDSQDYRCAECRAPISLRGVPSEARQCDYTG
QYYCSHCHWNDLAVIPARVVHNWDFEPRKVSRCSMRYLALMVSRPVLRLREINPLLFSYV
EELVEIRKLRQDILLMKPYFITCREAMEARLLLQLQDRQHFVENDEMYSVQDLLDVHAGR
LGCSLTEIHTLFAKHIKLDCERCQAKGFVCELCREGDVLFPFDSHTSVCADCSAVFHRDC
YYDNSTTCPKCARLSLRKQSLFQEPGPDVEA
Download sequence
Identical sequences ENSP00000456501 ENSP00000458019 gi|338797794|ref|NP_001229747.1| gi|338797798|ref|NP_001229749.1| NP_001229747.1.87134 NP_001229747.1.92137 NP_001229749.1.87134 NP_001229749.1.92137 XP_016878847.1.92137 XP_016878856.1.92137 XP_016878857.1.92137 ENSP00000456501 ENSP00000458019 ENSP00000482524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]