SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000456711 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000456711
Domain Number 1 Region: 122-369
Classification Level Classification E-value
Superfamily vWA-like 1.07e-85
Family Integrin A (or I) domain 0.00000000029
Further Details:      
 
Domain Number 2 Region: 365-455
Classification Level Classification E-value
Superfamily Integrin domains 1.62e-33
Family Integrin domains 0.0000031
Further Details:      
 
Domain Number 3 Region: 621-705
Classification Level Classification E-value
Superfamily Integrin beta tail domain 9.15e-24
Family Integrin beta tail domain 0.0000037
Further Details:      
 
Domain Number 4 Region: 18-72
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000942
Family Plexin repeat 0.0000277
Further Details:      
 
Domain Number 5 Region: 579-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000117
Family Integrin beta EGF-like domains 0.00033
Further Details:      
 
Domain Number 6 Region: 537-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000279
Family Integrin beta EGF-like domains 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSP00000456711
Domain Number - Region: 505-537
Classification Level Classification E-value
Superfamily EGF/Laminin 0.026
Family Integrin beta EGF-like domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000456711   Gene: ENSG00000259753   Transcript: ENST00000560629
Sequence length 787
Comment pep:known chromosome:GRCh38:17:47253897:47344292:1 gene:ENSG00000259753 transcript:ENST00000560629 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XTVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLL
KDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVR
QVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYM
YISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDA
IMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSAST
TMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIV
DAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRG
CPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPG
WLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFGKITGKYCECDD
FSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGS
CVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKEL
KDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDILVVLLSVMGAIL
LIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTEILLYYCSFILVHQSLESLRTEFT
SKQKDGN
Download sequence
Identical sequences H3BM21
ENSP00000456711 ENSP00000456711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]