SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000456799 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000456799
Domain Number 1 Region: 121-180
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000129
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.014
Further Details:      
 
Weak hits

Sequence:  ENSP00000456799
Domain Number - Region: 160-169,201-220,370-421
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00121
Family Cytochrome c3-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000456799   Gene: ENSG00000140995   Transcript: ENST00000570182
Sequence length 441
Comment pep:known chromosome:GRCh38:16:89948795:89968059:1 gene:ENSG00000140995 transcript:ENST00000570182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYDEKLARFRQAHLNPFNKQSGPRQHEQGPGEEVPDVTPEEALPELPPGEPEFRCPERV
MDLGLSEDHFSRPVLRQAIEECKQVILELPEQSEKQKDAVVRLIHLRLKLQELKDPNEDE
PNIRVLLEHRFYKEKSKSVKQTCDKCNTIIWGLIQTWYTCTGCYYRCHSKCLNLISKPCV
SSKVSHQAEYELNICPETGLDSQDYRCAECRAPISLRGVPSEARQCDYTGQYYCSHCHWN
DLAVIPARVVHNWDFEPRKVSRCSMRYLALMVSRPVLRLREINPLLFSYVEELVEIRKLR
QDILLMKPYFITCREAMEARLLLQLQDRQHFVENDEMYSVQDLLDVHAGRLGCSLTEIHT
LFAKHIKLDCERCQAKGFVCELCREGDVLFPFDSHTSVCADCSAVFHRDCYYDNSTTCPK
CARLSLRKQSLFQEPGPDVEA
Download sequence
Identical sequences gi|338797789|ref|NP_001229745.1| ENSP00000456799 ENSP00000456799 NP_001229745.1.87134 NP_001229745.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]