SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000456832 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000456832
Domain Number - Region: 88-136
Classification Level Classification E-value
Superfamily Cupredoxins 0.073
Family Multidomain cupredoxins 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000456832   Gene: ENSG00000255339   Transcript: ENST00000557395
Sequence length 172
Comment pep:known chromosome:GRCh38:10:100507446:100529881:-1 gene:ENSG00000255339 transcript:ENST00000557395 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAVARAGVLGVQWLQRASRNVMPLGARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVE
DYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTS
PTPVSWHVMCMQLFGFLAFMIFMCWVGDVYPVYQPVCRHHFSYNLGFLSALG
Download sequence
Identical sequences NP_001271296.1.87134 NP_001271296.1.92137 ENSP00000359344 ENSP00000433145 ENSP00000456832 ENSP00000359344 ENSP00000456832 ENSP00000455090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]