SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000456952 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000456952
Domain Number 1 Region: 127-210
Classification Level Classification E-value
Superfamily LCCL domain 9.02e-26
Family LCCL domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1-62
Classification Level Classification E-value
Superfamily PR-1-like 4.71e-19
Family PR-1-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000456952   Gene: ENSG00000103196   Transcript: ENST00000563066
Sequence length 210
Comment pep:putative chromosome:GRCh38:16:84842003:84873110:1 gene:ENSG00000103196 transcript:ENST00000563066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCTHYTQIVWATTNKIGCAVNTCRKMTVWGEVWENAVYFVCNYSPKGNWIGEAPYKNGRP
CSECPPSYGGSCRNNLCYREETYTPKPETDEMNEVETAPIPEENHVWLQPRVMRPTKPKK
TSAVNYMTQVVRCDTKMKDRCKGSTCNRYQCPAGCLNHKAKIFGTLFYESSSSICRAAIH
YGILDDKGGLVDITRNGKVPFFVKSERHGV
Download sequence
Identical sequences ENSP00000456952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]