SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000457239 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000457239
Domain Number 1 Region: 17-81
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.75e-19
Family Cell cycle transcription factor e2f-dp 0.0000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000457239   Gene: ENSG00000205250   Transcript: ENST00000569573
Sequence length 121
Comment pep:known chromosome:GRCh38:16:67192208:67196008:1 gene:ENSG00000205250 transcript:ENST00000569573 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAEAGPQAPPPPGTPSRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYD
ITNVLEGIGLIEKKSKNSIQWKRYPLGHPGPIRHQPGGAHPRGSQWAEEVPDSPEECEWS
H
Download sequence
Identical sequences A0A1D5QRT1 A0A2I2ZWQ6 A0A2I3LCH8 A0A2I3T0K6 A0A2J8VUM1 A0A2K5NRN9 A0A2K5TPE6 A0A2K5ZAY5 A0A2K6B322 A0A2K6MD91 A0A2K6Q4J2 H3BTM3
ENSP00000457239 ENSP00000457239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]