SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000457490 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000457490
Domain Number 1 Region: 2-74
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 2.75e-19
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000457490   Gene: ENSG00000138621   Transcript: ENST00000563393
Sequence length 81
Comment pep:putative chromosome:GRCh38:15:75043275:75049738:1 gene:ENSG00000138621 transcript:ENST00000563393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAWDRSKPLLFCPAMNTAMWEHPITAQQVDQLKAFGYVEIPCVAKKLVCGDEGLGAMAE
VGTIVDKVKEVLFQHSGFQQS
Download sequence
Identical sequences H3BU63
ENSP00000457490 ENSP00000457490 NP_001288033.1.87134 NP_001288033.1.92137 NP_001288034.1.87134 NP_001288034.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]