SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000457592 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000457592
Domain Number - Region: 37-68
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000305
Family FAD/NAD-linked reductases, N-terminal and central domains 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000457592   Gene: ENSG00000137767   Transcript: ENST00000565227
Sequence length 73
Comment pep:known chromosome:GRCh38:15:45631578:45659142:1 gene:ENSG00000137767 transcript:ENST00000565227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPLVAVVSGPRAQLFACLLRLGTQQVGPLQLHTGASHAARNHYEVLVLGGGSGGITMAA
RMKRKVGAENVAI
Download sequence
Identical sequences H3BUD7
ENSP00000457592 ENSP00000457592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]