SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000457608 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000457608
Domain Number 1 Region: 2-135
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 8.5e-28
Family Acetyl-CoA synthetase-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000457608   Gene: ENSG00000005187   Transcript: ENST00000569141
Sequence length 136
Comment pep:novel chromosome:GRCh38:16:20785050:20796929:1 gene:ENSG00000005187 transcript:ENST00000569141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XKWRNKTGLDIYEGYGQTETVLICGNFKGMKIKPGSMGKPSPAFDVKIVDVNGNVLPPGQ
EGDIGIQVLPNRPFGLFTHYVVVKAFVVLNPDYKSHDQEQLIKEIQEHVKKTTAPYKYPR
KVEFIQELPKTISGKT
Download sequence
Identical sequences ENSP00000457608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]