SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000457627 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000457627
Domain Number 1 Region: 131-190
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000126
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.014
Further Details:      
 
Domain Number 2 Region: 170-179,211-230,363-414
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0000628
Family Cytochrome c3-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000457627   Gene: ENSG00000140995   Transcript: ENST00000563795
Sequence length 434
Comment pep:known chromosome:GRCh38:16:89948803:89966306:1 gene:ENSG00000140995 transcript:ENST00000563795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYDEKLARFRQAHLNPFNKQSGPRQHEQGPGEEVPDVTPEEALPELPPGEPEFRCPERV
MDLGLSEDHFSRPVGLFLASDVQQLRQAIEECKQVILELPEQSEKQKDAVVRLIHLRLKL
QELKDPNEDEPNIRVLLEHRFYKEKSKSVKQTCDKCNTIIWGLIQTWYTCTGCYYRCHSK
CLNLISKPCVSSKVSHQAEYELNICPETGLDSQDYRCAECRAPISLRGVPSEARQCDYTG
QYYCSHCHWNDLAVIPARVVHNWDFEPRKVSRCSMRYLALMVSRPVLRLREINPLLFSYV
EELVEIRKLRQDILLMKPYFITCREAMEARLLLQDLLDVHAGRLGCSLTEIHTLFAKHIK
LDCERCQAKGFVCELCREGDVLFPFDSHTSVCADCSAVFHRDCYYDNSTTCPKCARLSLR
KQSLFQEPGPDVEA
Download sequence
Identical sequences ENSP00000457627 NP_001229748.1.87134 NP_001229748.1.92137 XP_005256375.2.92137 XP_016878849.1.92137 XP_016878858.1.92137 gi|338797796|ref|NP_001229748.1| ENSP00000457627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]