SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000457757 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000457757
Domain Number 1 Region: 48-114
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.8e-16
Family Transglutaminase, two C-terminal domains 0.0056
Further Details:      
 
Weak hits

Sequence:  ENSP00000457757
Domain Number - Region: 2-28
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.00515
Family Transglutaminase core 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000457757   Gene: ENSG00000166947   Transcript: ENST00000565459
Sequence length 147
Comment pep:putative chromosome:GRCh38:15:43205992:43207239:-1 gene:ENSG00000166947 transcript:ENST00000565459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRCEDITQNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPPSLETASPLYLLLKAPSSL
PLRGDAQISVTLVNHSEQEKAVQLAIGVQAVHYNGVLAAKLWRKKLHLTLSANLGNALWP
HQTPPDTHTHMAPALGRQQPQGTPCSL
Download sequence
Identical sequences H3BUR1
ENSP00000457757 ENSP00000457757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]