SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000458296 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000458296
Domain Number 1 Region: 10-192
Classification Level Classification E-value
Superfamily Rhomboid-like 2.35e-17
Family Rhomboid-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000458296   Gene: ENSG00000072849   Transcript: ENST00000571971
Sequence length 200
Comment pep:novel chromosome:GRCh38:17:5480071:5486178:-1 gene:ENSG00000072849 transcript:ENST00000571971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITN
FLFFGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTQSDRMSKSKEL
LTQAFTIMLVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVG
HIYFFLEDVFPNQPGGIRIL
Download sequence
Identical sequences A0A2J8KQD3 A0A2J8R7T0 I3L0R8
ENSP00000458296 ENSP00000458296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]