SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000459072 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000459072
Domain Number 1 Region: 13-108
Classification Level Classification E-value
Superfamily Rhomboid-like 0.0000000000000157
Family Rhomboid-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000459072   Gene: ENSG00000072849   Transcript: ENST00000570848
Sequence length 144
Comment pep:putative chromosome:GRCh38:17:5474610:5486178:-1 gene:ENSG00000072849 transcript:ENST00000570848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITN
FLFFGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTQSDRMSKSKEL
LTQVLQLDTYIFSWKMYFPINLVE
Download sequence
Identical sequences G3R4Z1 H2QC05 I3L1S8
ENSP00000459072 ENSP00000459072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]