SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000459083 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000459083
Domain Number 1 Region: 1-110
Classification Level Classification E-value
Superfamily Rhomboid-like 0.00000000497
Family Rhomboid-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000459083   Gene: ENSG00000072849   Transcript: ENST00000575605
Sequence length 158
Comment pep:novel chromosome:GRCh38:17:5474610:5482879:-1 gene:ENSG00000072849 transcript:ENST00000575605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WRLITNFLFFGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTQSDRM
SKSKELLTQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLEDVFPNQPGGIRILKT
PSILKAIFDTPDEDPNYNPLPEERPGGFAWGEGQRLGG
Download sequence
Identical sequences A0A2J8KQD7 A0A2J8R7T8 I3L1T3
ENSP00000459083 ENSP00000459083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]