SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000459192 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000459192
Domain Number 1 Region: 15-99
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.0000000123
Family Integrin alpha N-terminal domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000459192   Gene: ENSG00000129636   Transcript: ENST00000565940
Sequence length 113
Comment pep:putative chromosome:GRCh38:16:47448098:47459130:-1 gene:ENSG00000129636 transcript:ENST00000565940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XKPKVKVSFKNHSALITSVVPGDYDGDSQMDVLLTYLPKNYAKSELGAVIFWGQNQTLDP
NNMTILNRTFQDEPLIMDFNGDLIPDIFGITNESNQPQILLGGHTTLNAPHLF
Download sequence
Identical sequences I3L1X7
ENSP00000459192 ENSP00000459192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]