SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000459581 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000459581
Domain Number 1 Region: 77-113
Classification Level Classification E-value
Superfamily PA domain 0.0000275
Family PA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000459581   Gene: ENSG00000108523   Transcript: ENST00000573404
Sequence length 122
Comment pep:known chromosome:GRCh38:17:4940083:4942652:1 gene:ENSG00000108523 transcript:ENST00000573404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPAAFPLPVVVAAVLWGAAPTRGLIRATSDHNASMDFADLPALFGATLSQEGLQGFLVE
AHPDNACSPIAPPPPAPVNGSVFIALLRRFDCNFDLKVLNAQKAGYGAAVVHNVNSNELL
NM
Download sequence
Identical sequences A0A2J8KQP2 I3L2D4
ENSP00000459581 ENSP00000459581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]