SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000459585 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000459585
Domain Number 1 Region: 2-83
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.54e-17
Family Heat shock protein 90, HSP90, N-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000459585   Gene: ENSG00000126602   Transcript: ENST00000574175
Sequence length 108
Comment pep:known chromosome:GRCh38:16:3672802:3677570:-1 gene:ENSG00000126602 transcript:ENST00000574175 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XADRVEVYSRSAAPGSLGYQWLSDGSGVFEIAEASGVRTGTKIIIHLKSDCKEFSSEARV
RDVVTKYSNFVSFPLYLNGRRMNTLQEPVQGQALHWLRPARWWRRRAW
Download sequence
Identical sequences I3L2D5
ENSP00000459585 ENSP00000459585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]