SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000460659 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000460659
Domain Number 1 Region: 129-204
Classification Level Classification E-value
Superfamily Homeodomain-like 5.56e-26
Family Homeodomain 0.0000859
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000460659   Gene: ENSG00000120068   Transcript: ENST00000576562
Sequence length 242
Comment pep:novel chromosome:GRCh38:17:48613188:48614704:-1 gene:ENSG00000120068 transcript:ENST00000576562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSYFVNSLFSKYKTGESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHG
PSSLSTAPYQQNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGE
EAEGSEQSPSPTQLFPWMRPQAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSH
ALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKQKLERAPEAADEGDAQKGD
KK
Download sequence
Identical sequences A0A2J8J975 A0A2J8W973 A0A2K5L613 A0A2K5V8B1 A0A2K6CFW7 A0A2K6RUW7 A0A2K6V092 F1RWG3 I3L3R1 L5JQC8
ENSP00000460659 ENSP00000460659 XP_004764808.1.14098 XP_005257343.1.92137 XP_005583634.1.63531 XP_006924821.1.64745 XP_007176455.1.59432 XP_010357952.1.97406 XP_011287484.1.62641 XP_011380963.1.92234 XP_011723762.1.29376 XP_011901659.1.92194 XP_014961692.1.54773 XP_014974869.1.72884 XP_016787016.1.37143 XP_017352498.1.71028 XP_017920420.1.57651 XP_019271428.1.44245 XP_019652670.1.58354 XP_020922770.1.46622 XP_021526251.1.9421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]