SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000460671 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000460671
Domain Number 1 Region: 13-63
Classification Level Classification E-value
Superfamily Rhomboid-like 0.0000249
Family Rhomboid-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000460671   Gene: ENSG00000072849   Transcript: ENST00000572834
Sequence length 74
Comment pep:putative chromosome:GRCh38:17:5474452:5486162:-1 gene:ENSG00000072849 transcript:ENST00000572834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQVLQLDTY
IFSWKMYFPINLVE
Download sequence
Identical sequences A0A2I2ZPB5 A0A2I3SLK0 I3L3R8
ENSP00000460671 NP_001291708.1.87134 NP_001291708.1.92137 XP_019782384.1.83887 ENSP00000460671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]