SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000461006 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000461006
Domain Number - Region: 2-40
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.00246
Family Integrin alpha N-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000461006   Gene: ENSG00000005844   Transcript: ENST00000569725
Sequence length 41
Comment pep:putative chromosome:GRCh38:16:30474001:30479174:1 gene:ENSG00000005844 transcript:ENST00000569725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLATDPTDGSILACDPGLSRTCDQNTYLSGLCYLFRQNLQ
Download sequence
Identical sequences A0A2J8INY1 A0A2J8TKH3 I3L468
ENSP00000461006 ENSP00000461006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]