SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000461603 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000461603
Domain Number 1 Region: 6-78
Classification Level Classification E-value
Superfamily Rhomboid-like 0.000000000157
Family Rhomboid-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000461603   Gene: ENSG00000072849   Transcript: ENST00000571476
Sequence length 79
Comment pep:known chromosome:GRCh38:17:5474727:5486148:-1 gene:ENSG00000072849 transcript:ENST00000571476 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFF
GPVGFNFLFNMIFLFLVCL
Download sequence
Identical sequences I3L4W7
ENSP00000461603 ENSP00000461603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]