SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000461626 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000461626
Domain Number 1 Region: 133-380
Classification Level Classification E-value
Superfamily vWA-like 2.89e-86
Family Integrin A (or I) domain 0.00000000029
Further Details:      
 
Domain Number 2 Region: 29-83
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000011
Family Plexin repeat 0.0000277
Further Details:      
 
Domain Number 3 Region: 376-423
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000204
Family Integrin domains 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000461626   Gene: ENSG00000259207   Transcript: ENST00000571680
Sequence length 443
Comment pep:putative chromosome:GRCh38:17:47253853:47291487:1 gene:ENSG00000259207 transcript:ENST00000571680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLG
SPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRP
DDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFG
AFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSR
NRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCH
VGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLS
MDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDT
VRWAGQGLCPGASVGTQPPFFLL
Download sequence
Identical sequences I3L4X8
ENSP00000461626 ENSP00000461626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]