SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000461635 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000461635
Domain Number 1 Region: 8-59
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000536
Family SIAH, seven in absentia homolog 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000461635   Gene: ENSG00000132530   Transcript: ENST00000571135
Sequence length 128
Comment pep:known chromosome:GRCh38:17:6756077:6760479:1 gene:ENSG00000132530 transcript:ENST00000571135 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MEGDFSVCRNCKRHVVSANFTLHEAYCLRFLVLCPECEEPVPKETMEEHCKLEHQQAYGS
GIGKRFWFQERLAVLLRSVKRGCEKGRSWKAVRWSPVSRLSMSIPPGAPDLSLWRYSSSG
SRCQLRLV
Download sequence
Identical sequences I3L534
ENSP00000461635 ENSP00000461750 ENSP00000461635 ENSP00000461750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]