SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000462228 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000462228
Domain Number 1 Region: 3-89
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.0000000275
Family Toll/Interleukin receptor TIR domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000462228   Gene: ENSG00000004139   Transcript: ENST00000579593
Sequence length 107
Comment pep:putative chromosome:GRCh38:17:28388270:28396820:1 gene:ENSG00000004139 transcript:ENST00000579593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVMGARNFVLVLSPGALDKCMQDHDC
KDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIK
Download sequence
Identical sequences J3KRZ6
ENSP00000462228 ENSP00000462228 ENSP00000466350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]