SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000462249 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000462249
Domain Number 1 Region: 1-48
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00000000000542
Family Ribosomal proteins L24p and L21e 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000462249   Gene: ENSG00000161970   Transcript: ENST00000584441
Sequence length 63
Comment pep:novel chromosome:GRCh38:17:8377538:8379936:-1 gene:ENSG00000161970 transcript:ENST00000584441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKLGSVFFLFFCRWL
SLG
Download sequence
Identical sequences J3KS10
ENSP00000462249 ENSP00000462249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]