SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000462339 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000462339
Domain Number - Region: 94-146
Classification Level Classification E-value
Superfamily G protein-binding domain 0.00942
Family RhoA-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000462339   Gene: ENSG00000198933   Transcript: ENST00000578982
Sequence length 195
Comment pep:known chromosome:GRCh38:17:47694081:47698726:1 gene:ENSG00000198933 transcript:ENST00000578982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESMFEDDISILTQEALGPSEVWLDSPGDPSLGGDMCSASHFALITAYGDIKERLGGLER
ENATLRRRLKVYEIKYPLISDFGEEHGFSLYEIKDGSLLEVEKVSLQQRLNQFQHELQKN
KEQEEQLGEMIQAYEKLCVEKSDLETELREMRALVETHLRQICGLEQQLRQQQGLQDAAF
SNLSPPPAPAPPCTD
Download sequence
Identical sequences J3KS71
ENSP00000462339 ENSP00000462339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]