SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000462717 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000462717
Domain Number 1 Region: 41-93
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000105
Family CUE domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000462717   Gene: ENSG00000180891   Transcript: ENST00000577830
Sequence length 386
Comment pep:known chromosome:GRCh38:17:57861243:57955323:-1 gene:ENSG00000180891 transcript:ENST00000577830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLFRRSSSGSGGGGTAGARGGGGGTAAPQELNNSRPARQVRRLEFNQAMDDFKTMFPN
MDYDIIECVLRANSGAVDATIDQLLQMNLEGGGSSGGVYEDSSDSEDSIPPEILERTLEP
DSSDEEPPPVYSPPAYHMHVFDRPYPLAPPTPPPRIDALGSGAPTSQRRYRNWNPPLLGN
LPDDFLRILPQQLDSIQGNAGGPKPGSGEGCPPAMAGPGPGDQESRWKQYLEDERIALFL
QNEEFMKELQRNRDFLLALERDRLKYESQKSKSSSVAVGNDFGFSSPVPGTGDANPAVSE
DALFRDKLKHMGKSTRRKLFELARAFSEKTKMRKSKRKHLLKHQSLGAAASTANLLDDVE
GHACDEDFRGRRQEAPKVEEGLREGQ
Download sequence
Identical sequences Q9NWM3
ENSP00000353373 ENSP00000384712 ENSP00000462717 NP_001258804.1.87134 NP_001258804.1.92137 NP_001278954.1.87134 NP_001278954.1.92137 XP_006721963.1.92137 gi|8923665|ref|NP_060419.1| ENSP00000353373 ENSP00000353373 ENSP00000384712 ENSP00000462717 9606.ENSP00000353373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]