SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000462747 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000462747
Domain Number - Region: 39-140
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 0.000288
Family Supernatant protein factor (SPF), C-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000462747   Gene: ENSG00000259900   Transcript: ENST00000564737
Sequence length 172
Comment pep:known chromosome:GRCh38:16:69335301:69351730:-1 gene:ENSG00000259900 transcript:ENST00000564737 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XGLVVLNLVTSARSQKTEPLSGSGDQPLFRGADRYDFAIMIPPGGTECFWQFAHQTGYFY
FSYEVQRTVGMSHDRHVAATAHNPQGFLIDTSQGVRGQINFSTQETGFYQLCLSNQHNHF
GSVQVYLNFGVFYEGPETDHKQKERKQLNDTLDAIEELCEGSRGDQLQPPDE
Download sequence
Identical sequences J3KT08
ENSP00000462747 ENSP00000464417 ENSP00000462747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]