SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000462748 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000462748
Domain Number 1 Region: 5-48
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000314
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000462748   Gene: ENSG00000154040   Transcript: ENST00000579102
Sequence length 84
Comment pep:known chromosome:GRCh38:18:24139625:24155754:1 gene:ENSG00000154040 transcript:ENST00000579102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVK
QFHQIKVEKWSEGTTPQKKLECLK
Download sequence
Identical sequences J3KT09
ENSP00000462748 ENSP00000462748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]