SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000462972 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000462972
Domain Number 1 Region: 40-199,227-251,306-368
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2e-53
Family N-terminal domain of adrenodoxin reductase-like 0.00000467
Further Details:      
 
Domain Number 2 Region: 338-496
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.000000023
Family N-terminal domain of adrenodoxin reductase-like 0.000000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000462972   Gene: ENSG00000161513   Transcript: ENST00000581530
Sequence length 497
Comment pep:known chromosome:GRCh38:17:74862501:74872961:-1 gene:ENSG00000161513 transcript:ENST00000581530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRCWRWWGWSAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVVGSGPAGFYTAQHLLKH
PQAHVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVEVGRDVTVP
ELQEAYHAVVLSYGAEDHRALEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAV
ILGQGNVALDVARILLTPPEHLEALLLCQRTDITKAALGVLRQSRVKTVWLVGRRGPLQV
AFTIKELREMIQLPGARPILDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAA
RQASASRAWGLRFFRSPQQVLPSPDGRRAAGVRLAVTRLEGVDEATRAVPTGDMEDLPCG
LVLSSIGYKSRPVDPSVPFDSKLGVIPNVEGRVMDVPGLYCSGWVKRGPTGVIATTMTDS
FLTGQMLLQDLKAGLLPSGPRPGYAAIQALLSSRGVRPVSFSDWEKLDAEEVARGQGTGK
PREKLVDPQEMLRLLGH
Download sequence
Identical sequences A0A0C4DGN7
NP_004101.3.87134 NP_004101.3.92137 ENSP00000462972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]