SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000463308 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000463308
Domain Number 1 Region: 8-147
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 7.06e-37
Family N-terminal domain of adrenodoxin reductase-like 0.0000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000463308   Gene: ENSG00000161513   Transcript: ENST00000579893
Sequence length 164
Comment pep:putative chromosome:GRCh38:17:74864896:74868631:-1 gene:ENSG00000161513 transcript:ENST00000579893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDKDREQHPQAHVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNV
EVGRDVTVPELQEAYHAVVLSYGAEDHRALEIPGEELPGVCSARAFVGWYNGLPENQELE
PDLSCDTAVILGQGNVALDVARILLTPPEHLERTDITKAALGVL
Download sequence
Identical sequences J3QKZ8
ENSP00000463308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]