SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000463345 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000463345
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000217
Family PBS lyase HEAT-like repeat 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000463345   Gene: ENSG00000154845   Transcript: ENST00000580745
Sequence length 135
Comment pep:putative chromosome:GRCh38:18:9588138:9615240:-1 gene:ENSG00000154845 transcript:ENST00000580745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTPLGRLDKYAASENIFNRQMVARSLLDTLREVCDDERDCIAVLERISRLADDSEPTVR
AELMEQVPHIALFCQENRPSIPYAFSKFLLPIVVRYLADQNNQVRKTSQAALLALLEQEL
IERFDVETKVCPVLI
Download sequence
Identical sequences J3QL26
ENSP00000463345 ENSP00000463345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]