SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000463386 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000463386
Domain Number 1 Region: 19-145
Classification Level Classification E-value
Superfamily Lysozyme-like 5.94e-47
Family C-type lysozyme 0.0000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000463386   Gene: ENSG00000141316   Transcript: ENST00000580599
Sequence length 146
Comment pep:putative chromosome:GRCh38:17:32970376:32997877:1 gene:ENSG00000141316 transcript:ENST00000580599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLALVCLLSCLLPSSEAKLYGRCELARVLHDFGLDGYRGYSLADWVCLAYFTSGFNAAA
LDYEADGSTNNGIFQINSRRWCSNLTPNVPNVCRMYCSDLLNPNLKDTVICAMKITQEPQ
GLGYWEAWRHHCQGKDLTEWVDGCDF
Download sequence
Identical sequences XP_018882069.1.27298 XP_018882070.1.27298 ENSP00000463386 ENSP00000463386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]