SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000463636 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000463636
Domain Number 1 Region: 20-231
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-72
Family Protein kinases, catalytic subunit 0.0000000415
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000463636   Gene: ENSG00000178999   Transcript: ENST00000577833
Sequence length 231
Comment pep:putative chromosome:GRCh38:17:8205265:8210568:-1 gene:ENSG00000178999 transcript:ENST00000577833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSNVQPTAAPGQKVMENSSGTPDILTRRHFTIDDFEIGRPLGKGKFGNVYLAREKKSH
FIVALKVLFKSQIEKEGVEHQLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRG
ELYKELQKSCTFDEQRTATIMEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFG
WSVHAPSLRRKTMCGTLDYLPPEMIEGRMHNEKVDLWCIGVLCYELLVGNP
Download sequence
Identical sequences ENSP00000463636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]